PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G219800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 349aa    MW: 38173.9 Da    PI: 6.4322
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G219800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.8e-102743092055
                         HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Brast06G219800.1.p 274 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 309
                         4679*****************************885 PP

2ELK37.83.9e-13229250122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLl+KYsgyL+sL+qEFs
  Brast06G219800.1.p 229 ELKYQLLKKYSGYLSSLRQEFS 250
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.9E-2187131IPR005540KNOX1
PfamPF037901.9E-2188128IPR005540KNOX1
SMARTSM012562.7E-29134185IPR005541KNOX2
PfamPF037913.7E-24140184IPR005541KNOX2
PfamPF037894.2E-10229250IPR005539ELK domain
SMARTSM011881.2E-7229250IPR005539ELK domain
PROSITE profilePS5121311.627229249IPR005539ELK domain
PROSITE profilePS5007112.892249312IPR001356Homeobox domain
SuperFamilySSF466891.2E-19250323IPR009057Homeodomain-like
SMARTSM003894.4E-13251316IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.6E-28254313IPR009057Homeodomain-like
CDDcd000865.52E-13261313No hitNo description
PfamPF059209.7E-17269308IPR008422Homeobox KN domain
PROSITE patternPS000270287310IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDQSSFGNIL GGGGAGGSSK ASFLQLQPLS PMGGGGAYYG TPLALHQAQQ AAAAAGGSSS  60
SSQYGHQQYS QRHGGSGGAE ISAAEAEAIK AKIVAHPQYS ALLAAYLDCQ KVGAPPEVME  120
RLTAMAAKLP SPGGHEQQRG DPELDQFMEA YCNMLAKYRE ELTRPIEEAM EFLKRVEAQL  180
DSITGASSAR LSLLADGKSE GVGSSEDDMD VSGRENDPPE IDPRAEDKEL KYQLLKKYSG  240
YLSSLRQEFS KKKKKGKLPK EARQKLLHWW ELHYKWPYPS ETEKIALAES TGLDQKQINN  300
WFINQRKRHW KPSEDMPFVM MEGFHPQNAA ALYMDGQFMA DGMYRLGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1014690.0FP101469.1 Phyllostachys edulis cDNA clone: bphyst005d10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557608.10.0PREDICTED: homeobox protein knotted-1-like 12
SwissprotO650341e-168KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804161e-168KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLA0A0Q3NTW80.0A0A0Q3NTW8_BRADI; Uncharacterized protein
STRINGBRADI1G57607.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-101KNOTTED-like from Arabidopsis thaliana